merchantprefsservice-paypalnpm
Malicious code in merchantprefsservice-paypal (npm) Remove it immediately and rotate any exposed credentials.
What this malware does
The OpenSSF Package Analysis project identified 'merchantprefsservice-paypal' @ 28.0.0 (npm) as malicious.
It is considered malicious because:
- The package communicates with a domain associated with malicious activity.
Malicious versions
Indicators of compromise (SHA-256)
Detection & response playbook
Malicious packageFind it
Scan your lockfiles (package-lock.json, pnpm-lock.yaml, yarn.lock, requirements.txt, poetry.lock, etc.) and build artifacts for merchantprefsservice-paypal (version 28.0.0). O3 Security's supply-chain scanner checks every dependency against known-malicious package intelligence at install time and in CI, flagging merchantprefsservice-paypal across your stack and pipelines.
If you installed it — respond
Remove merchantprefsservice-paypal from your project and lockfile, then assume any secrets accessible to the build or runtime were exposed: rotate API keys, tokens, and credentials, and audit for unexpected outbound activity or persistence.
Did it already run?
If merchantprefsservice-paypal was ever installed, its post-install/runtime payload may have already executed. O3's L7 egress monitoring and runtime eBPF sensors detect the credential exfiltration or command-and-control callback after install and block the malicious outbound channel, so you catch and contain the actual compromise — not just the presence of the package.
How O3 protects you
O3 blocks merchantprefsservice-paypal before install through its supply-chain scanner, and if it has already run, detects and severs the exfiltration or C2 callback at runtime through L7 egress monitoring and eBPF.
Frequently asked questions
Credits
- OpenSSF: Package Analysis · finder
Detect & block this
O3 blocks merchantprefsservice-paypal-class packages before install and in CI — and if it already ran, its runtime egress monitoring catches the malicious outbound activity and severs the channel.