Your RSA-2048 keys break in 2030. Find every one of them before attackers do.
Malicious package

merchantprefsservice-paypalnpm

merchantprefsservice-paypal is a confirmed malicious npm package (MAL-2026-11057) that steals credentials and exfiltrates sensitive data (malicious versions 4.0.0, 24.0.0, 28.0.0). Do not install it — remove it immediately and rotate any exposed credentials.

Malicious code in merchantprefsservice-paypal (npm)

MAL-2026-11057
Immediate action
Remove the package, then rotate any secrets the build/runtime could reach.
npm uninstall merchantprefsservice-paypal

What this malware does

The package's preinstall script (index.js) executes automatically on npm install and collects host identifiers — hostname, platform, arch, home directory path, and configured DNS servers — then POSTs them to the hardcoded Burp Collaborator subdomain fdw2vnyonnpdk7x3ntotw7omtdz5n4bt.oastify.com at path /hit. The package name mimics an internal PayPal-namespaced service, consistent with a dependency-confusion beacon that fires when a developer or build system inadvertently resolves the public name over an intended private one. The exfiltrated DNS server list additionally reveals internal network configuration.

Any computer that has this package installed or running should be considered fully compromised. All secrets and keys stored on that computer should be rotated immediately from a different computer. The package should be removed, but as full control of the computer may have been given to an outside entity, there is no guarantee that removing the package will remove all malicious software resulting from installing it.

The OpenSSF Package Analysis project identified 'merchantprefsservice-paypal' @ 28.0.0 (npm) as malicious.

It is considered malicious because:

  • The package communicates with a domain associated with malicious activity.

Malicious versions

3 flagged
4.0.024.0.028.0.0

Indicators of compromise (SHA-256)

1d3ce91132c1aa082533f130bf0d67c0369ebeb3564c49a134004da1cf9f29fc
3cb0650e6084dbdffdf3011ee427b9997afa2ff2778d43e5e7929945cd14f54a
145fc1d224cc012a8cbdea5823b1573df6400ce6a24837b2c25710772152724f
513866f6885556cdc4f18929c68eb4443b0c7f66d331b132a6cc47638b143453
7ce7e033d1d3c45158a952272cab890c426353b37a6b8ac151e5f4460096d4c2

Detection & response playbook

Credential / info stealer
  1. Find it

    Scan your lockfiles (package-lock.json, pnpm-lock.yaml, yarn.lock, requirements.txt, poetry.lock, etc.) and build artifacts for merchantprefsservice-paypal (3 malicious versions). O3 Security's supply-chain scanner checks every dependency against known-malicious package intelligence at install time and in CI, flagging merchantprefsservice-paypal across your stack and pipelines.

  2. If you installed it — respond

    merchantprefsservice-paypal is built to steal secrets, so assume every credential the build or runtime could read is compromised. Remove it from your project and lockfile, then rotate ALL exposed secrets — npm/registry tokens, cloud keys, CI/CD secrets, SSH keys, and any .env values — from a known-clean machine. Audit logs for unauthorized use of those credentials.

  3. Did it already run?

    If merchantprefsservice-paypal was ever installed, its post-install/runtime payload may have already executed. O3's L7 egress monitoring and runtime eBPF sensors detect the credential exfiltration or command-and-control callback after install and block the malicious outbound channel, so you catch and contain the actual compromise — not just the presence of the package.

  4. How O3 protects you

    O3 blocks merchantprefsservice-paypal before install through its supply-chain scanner, and if it has already run, detects and severs the exfiltration or C2 callback at runtime through L7 egress monitoring and eBPF.

Frequently asked questions

No. merchantprefsservice-paypal on npm has been identified as a malicious package (versions 4.0.0, 24.0.0, 28.0.0 flagged). It should be removed immediately — do not install or keep it in your dependency tree.

Campaign

GHSA-w6fc-gq73-j24mIN-MAL-2026-011121IN-MAL-2026-013288IN-MAL-2026-013290

References

Credits

  • Amazon Inspector · finder
  • OpenSSF: Package Analysis · finder

Detect & block this

O3 blocks merchantprefsservice-paypal-class packages before install and in CI — and if it already ran, its runtime egress monitoring catches the credential exfiltration and severs the channel.

Explore

merchantprefsservice-paypal (npm) malicious package — MAL-2026-11057 | O3 Security